Connexin 62/GJA10 Antibody

Images

 
Western Blot: GJA10 Antibody [NBP2-14050] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GJA10 Antibody [NBP2-14050] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Connexin 62/GJA10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEGIEDETGPPFHLKKYSVAQQCMICSSLPERISPLQANNQQQVIRVNVP KSKTMWQIPQPRQLEVDPSNGKKDWSEKDQHSGQLHVHSPCPWAGSAGNQ HLGQQSDHSSFGLQNTMSQSWLGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GJA10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Connexin 62/GJA10 Protein (NBP2-14050PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Connexin 62/GJA10 Antibody

  • Connexin 62
  • connexin-62
  • Cx62
  • CX62gap junction alpha-10 protein
  • gap junction protein, alpha 10, 62kDa
  • GJA10
  • RP11-63K6.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-59196
Species: Hu
Applications: WB
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14050
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Connexin 62/GJA10 Antibody (NBP2-14050) (0)

There are no publications for Connexin 62/GJA10 Antibody (NBP2-14050).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 62/GJA10 Antibody (NBP2-14050) (0)

There are no reviews for Connexin 62/GJA10 Antibody (NBP2-14050). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 62/GJA10 Antibody (NBP2-14050) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Connexin 62/GJA10 Products

Bioinformatics Tool for Connexin 62/GJA10 Antibody (NBP2-14050)

Discover related pathways, diseases and genes to Connexin 62/GJA10 Antibody (NBP2-14050). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 62/GJA10 Antibody (NBP2-14050)

Discover more about diseases related to Connexin 62/GJA10 Antibody (NBP2-14050).
 

Pathways for Connexin 62/GJA10 Antibody (NBP2-14050)

View related products by pathway.

PTMs for Connexin 62/GJA10 Antibody (NBP2-14050)

Learn more about PTMs related to Connexin 62/GJA10 Antibody (NBP2-14050).

Blogs on Connexin 62/GJA10

There are no specific blogs for Connexin 62/GJA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Connexin 62/GJA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GJA10
Entrez