Recombinant Human Connexin 50/GJA8 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Connexin 50/GJA8 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 301-410 of Human Connexin 50/GJA8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GJA8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Connexin 50/GJA8 GST (N-Term) Protein

  • alpha 8, 50kD (connexin 50)
  • CAE
  • CAE1
  • Connexin 50
  • Connexin-50
  • CX50
  • CZP1
  • gap junction alpha-8 protein
  • gap junction membrane channel protein alpha-8
  • gap junction protein, alpha 8, 50kDa (connexin 50)
  • gap junction protein, alpha 8, 50kDa
  • GJA8
  • lens intrinsic membrane protein MP70
  • MP70

Background

GJA8 - gap junction protein, alpha 8, 50kDa (connexin 50)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59197
Species: Hu
Applications: WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-76925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-04895
Species: Hu, Mu, Rt
Applications: WB
NBP2-46354
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
H00001415-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-32557
Species: Hu, Mu
Applications: WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
NBP1-33010
Species: Hu, Mu
Applications: ICC/IF, WB
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
H00002703-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01) (0)

There are no publications for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01) (0)

There are no reviews for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 50/GJA8 Products

Bioinformatics Tool for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01)

Discover related pathways, diseases and genes to Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01)

Discover more about diseases related to Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01).
 

Pathways for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01)

View related products by pathway.

PTMs for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01)

Learn more about PTMs related to Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01).
 

Research Areas for Connexin 50/GJA8 Partial Recombinant Protein (H00002703-Q01)

Find related products by research area.

Blogs on Connexin 50/GJA8

There are no specific blogs for Connexin 50/GJA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Connexin 50/GJA8 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GJA8