Recombinant Human Connexin 32/GJB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Connexin 32/GJB1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human GJB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GJB1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Connexin 32/GJB1 Protein

  • CMTX
  • CMTX1
  • Connexin 32
  • Connexin-32
  • CX32
  • CX32beta 1, 32kD (connexin 32, Charcot-Marie-Toothneuropathy, X-linked)
  • gap junction beta-1 protein
  • gap junction protein, beta 1, 32kDa (connexin 32)
  • gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Toothneuropathy, X-linked)
  • gap junction protein, beta 1, 32kDa
  • GJB1

Background

GJB1 - gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-88040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58660
Species: Hu
Applications: IHC-P
H00002705-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01) (0)

There are no publications for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01) (0)

There are no reviews for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 32/GJB1 Products

Bioinformatics Tool for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01)

Discover related pathways, diseases and genes to Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01)

Discover more about diseases related to Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01).
 

Pathways for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01)

View related products by pathway.

PTMs for Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01)

Learn more about PTMs related to Connexin 32/GJB1 Partial Recombinant Protein (H00002705-Q01).

Blogs on Connexin 32/GJB1

There are no specific blogs for Connexin 32/GJB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EGR2 Antibody
NB110-59723

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Connexin 32/GJB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GJB1
Entrez