CNGA3 Recombinant Protein Antigen

Images

 
There are currently no images for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CNGA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNGA3.

Source: E.coli

Amino Acid Sequence: FLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CNGA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68684. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CNGA3 Recombinant Protein Antigen

  • CCNC1
  • CCNCa
  • CCNCalpha
  • CNCG3
  • CNG channel alpha-3
  • CNG-3
  • CNG3ACHM2
  • cone photoreceptor cGMP-gated channel alpha subunit
  • Cone photoreceptor cGMP-gated channel subunit alpha
  • cyclic nucleotide gated channel alpha 3
  • cyclic nucleotide-gated cation channel alpha-3
  • Cyclic nucleotide-gated channel alpha-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75087
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00002780-P01
Species: Hu
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003757-Q01
Species: Hu
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-76924
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-22457
Species: Rt
Applications: WB
H00005146-Q01
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-74460
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF2945
Species: Hu
Applications: WB
NBP2-20696
Species: Hu, Mu
Applications: WB, IHC-Fr
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
H00001262-P01
Species: Hu
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA

Publications for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP) (0)

There are no publications for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP) (0)

There are no reviews for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CNGA3 Products

Bioinformatics Tool for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP)

Discover related pathways, diseases and genes to CNGA3 Recombinant Protein Antigen (NBP2-68684PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP)

Discover more about diseases related to CNGA3 Recombinant Protein Antigen (NBP2-68684PEP).
 

Pathways for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP)

View related products by pathway.

PTMs for CNGA3 Recombinant Protein Antigen (NBP2-68684PEP)

Learn more about PTMs related to CNGA3 Recombinant Protein Antigen (NBP2-68684PEP).

Blogs on CNGA3

There are no specific blogs for CNGA3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CNGA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CNGA3