CMTM2 Antibody - BSA Free

Western Blot: CMTM2 Antibody [NBP1-59439] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Discontinued

CMTM2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CMTM2(CKLF-like MARVEL transmembrane domain containing 2) The peptide sequence was selected from the N terminal of CMTM2. Peptide sequence DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CMTM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry reported in scientific literature (PMID:31990600).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CMTM2 Antibody - BSA Free

• chemokine-like factor super family 2
• chemokine-like factor superfamily 2
• Chemokine-like factor superfamily member 2
• CKLF-like MARVEL transmembrane domain containing 2
• CKLF-like MARVEL transmembrane domain-containing protein 2
• CKLFSF2
• FLJ25732
• MGC39436

Background

CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CMTM2 Antibody (NBP1-59439)(3)

Publications using NBP1-59439

• Qian C, Xu Z, Chen L et al. Long noncoding RNA LINC01391 restrained gastric cancer aerobic glycolysis and tumorigenesis via targeting miR-12116/CMTM2 axis J Cancer 2020-10-09 [PMID: 33033510]
• Zhang S, Tian R, Bei C et al. Down-Regulated CMTM2 Promotes Epithelial-Mesenchymal Transition in Hepatocellular Carcinoma OTT 2020-06-01 [PMID: 32606785] (WB, Human)
• Guo X, Zhang S, Tan S et al. Downregulated CMTM2 Poses Potential Clinical Significance in Hepatocellular Carcinoma DNA Cell Biol. 2020-01-28 [PMID: 31990600] (IF/IHC)

Bioinformatics

• Gene Symbol: CMTM2
• Uniprot:
  • Q8TAZ6(Human)