CMSS1 Antibody

Images

 
Western Blot: CMSS1 Antibody [NBP2-82707] - Host: Rabbit. Target Name: C3orf26. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMSS1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CMSS1. Peptide sequence: KTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CMSS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CMSS1 Antibody

  • C3orf26
  • chromosome 3 open reading frame 26
  • cms1 ribosomal small subunit homolog (yeast)
  • hypothetical protein LOC84319
  • MGC4308

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45634
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-34152
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91708
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for CMSS1 Antibody (NBP2-82707) (0)

There are no publications for CMSS1 Antibody (NBP2-82707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMSS1 Antibody (NBP2-82707) (0)

There are no reviews for CMSS1 Antibody (NBP2-82707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CMSS1 Antibody (NBP2-82707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CMSS1 Products

Bioinformatics Tool for CMSS1 Antibody (NBP2-82707)

Discover related pathways, diseases and genes to CMSS1 Antibody (NBP2-82707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CMSS1 Antibody (NBP2-82707)

View related products by pathway.

Blogs on CMSS1

There are no specific blogs for CMSS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMSS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CMSS1