CHST13 Antibody

Images

 
Western Blot: CHST13 Antibody [NBP1-62294] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHST13 Antibody Summary

Immunogen
Synthetic peptides corresponding to CHST13(carbohydrate (chondroitin 4) sulfotransferase 13) The peptide sequence was selected from the C terminal of CHST13. Peptide sequence CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHST13 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHST13 Antibody

  • C4ST-3
  • C4ST3MGC119279
  • carbohydrate (chondroitin 4) sulfotransferase 13
  • carbohydrate sulfotransferase 13
  • Chondroitin 4-O-sulfotransferase 3
  • Chondroitin 4-sulfotransferase 3
  • EC 2.8.2.5
  • MGC119278
  • MGC119281

Background

CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. It transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. C4ST3 transfers sulfate to the C-4 hydroxyl of beta-1,4-linked GalNAc flanked by GlcUA residues in chondroitin (Kang et al., 2002 [PubMed 12080076]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83396
Species: Hu
Applications: IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-62294
Species: Hu
Applications: WB

Publications for CHST13 Antibody (NBP1-62294) (0)

There are no publications for CHST13 Antibody (NBP1-62294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST13 Antibody (NBP1-62294) (0)

There are no reviews for CHST13 Antibody (NBP1-62294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHST13 Antibody (NBP1-62294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHST13 Products

Bioinformatics Tool for CHST13 Antibody (NBP1-62294)

Discover related pathways, diseases and genes to CHST13 Antibody (NBP1-62294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CHST13 Antibody (NBP1-62294)

View related products by pathway.

Research Areas for CHST13 Antibody (NBP1-62294)

Find related products by research area.

Blogs on CHST13

There are no specific blogs for CHST13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHST13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST13
Uniprot