CHERP Antibody [mFluor Violet 450 SE]

Product Discontinued

CHERP Antibody [mFluor Violet 450 SE] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3).
  
  Sequence:
  LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHERP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for CHERP Antibody [mFluor Violet 450 SE]

• calcium homeostasis endoplasmic reticulum protein
• DAN16
• DAN26
• ERPROT 213-21
• ERPROT213-21
• protein with polyglutamine repeat
• SCAF6
• SRA1
• SR-related CTD associated factor 6
• SR-related CTD-associated factor 6

Background

CHERP (calcium homeostasis endoplasmic reticulum protein) influences cytoplasmic Ca2+ levels, and hence calcium-mediated processes such as cell proliferation. How it exerts its effects is currently under debate; it may be via Ins(1,4,5)P3 receptors and/or RyR 1 (ryanodine type 1) receptors (both calcium channels), and/or the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHERP