CHERP Antibody [CoraFluor™ 1]

CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.

Product Discontinued

CHERP Antibody [CoraFluor™ 1] Summary

• Description: CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
  
  CoraFluor(TM) 1, amine reactive
  
  CoraFluor(TM) 1, thiol reactive
  
  For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3).
  
  Sequence:
  LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHERP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark. Do not freeze.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for CHERP Antibody [CoraFluor™ 1]

• calcium homeostasis endoplasmic reticulum protein
• DAN16
• DAN26
• ERPROT 213-21
• ERPROT213-21
• protein with polyglutamine repeat
• SCAF6
• SRA1
• SR-related CTD associated factor 6
• SR-related CTD-associated factor 6

Background

CHERP (calcium homeostasis endoplasmic reticulum protein) influences cytoplasmic Ca2+ levels, and hence calcium-mediated processes such as cell proliferation. How it exerts its effects is currently under debate; it may be via Ins(1,4,5)P3 receptors and/or RyR 1 (ryanodine type 1) receptors (both calcium channels), and/or the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHERP