CHERP Antibody (1A5) - Azide and BSA Free

Western Blot: CHERP Antibody (1A5) [H00010523-M02] - Detection against Immunogen (35.53 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CHERP Antibody (1A5) - Azide and BSA Free Summary

• Immunogen: CHERP (AAH21294.1, 795 a.a. ~ 883 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARDEC
• Specificity: CHERP - calcium homeostasis endoplasmic reticulum protein (1A5)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CHERP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHERP Antibody (1A5) - Azide and BSA Free

• calcium homeostasis endoplasmic reticulum protein
• DAN16
• DAN26
• ERPROT 213-21
• ERPROT213-21
• protein with polyglutamine repeat
• SCAF6
• SRA1
• SR-related CTD associated factor 6
• SR-related CTD-associated factor 6

Background

CHERP (calcium homeostasis endoplasmic reticulum protein) influences cytoplasmic Ca2+ levels, and hence calcium-mediated processes such as cell proliferation. How it exerts its effects is currently under debate; it may be via Ins(1,4,5)P3 receptors and/or RyR 1 (ryanodine type 1) receptors (both calcium channels), and/or the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHERP
• Entrez:
  • 10523(Human)
• Uniprot:
  • NP_006378(Human)