Recombinant Human CEP290 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CEP290 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-164 of Human Cep290 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CEP290
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
45.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CEP290 GST (N-Term) Protein

  • BBS14Bardet-Biedl syndrome 14 protein
  • Cancer/testis antigen 87
  • centrosomal protein 290kDa
  • Cep290
  • CT87JBTS6
  • FLJ13615
  • JBTS5CTCL tumor antigen se2-2
  • KIAA0373FLJ21979
  • LCA10monoclonal 3H11 antigen
  • MKS4
  • Nephrocystin-6
  • NPHP6centrosomal protein of 290 kDa
  • POC3 centriolar protein homolog
  • POC3
  • prostate cancer antigen T21
  • rd16,3H11AG
  • SLSN6nephrocytsin-6,3H11Ag
  • Tumor antigen se2-2

Background

This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88692
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, CyTOF-ready, IF
NBP2-98647
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-53232
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: IHC, IHC-P
NBP2-14126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47626
Species: Hu
Applications: ELISA, IHC, IHC-P, PEP-ELISA
H00145226-D01P
Species: Hu
Applications: WB
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00080184-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CEP290 Recombinant Protein (H00080184-P01) (0)

There are no publications for CEP290 Recombinant Protein (H00080184-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP290 Recombinant Protein (H00080184-P01) (0)

There are no reviews for CEP290 Recombinant Protein (H00080184-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEP290 Recombinant Protein (H00080184-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CEP290 Products

Array H00080184-P01

Bioinformatics Tool for CEP290 Recombinant Protein (H00080184-P01)

Discover related pathways, diseases and genes to CEP290 Recombinant Protein (H00080184-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP290 Recombinant Protein (H00080184-P01)

Discover more about diseases related to CEP290 Recombinant Protein (H00080184-P01).
 

Pathways for CEP290 Recombinant Protein (H00080184-P01)

View related products by pathway.

PTMs for CEP290 Recombinant Protein (H00080184-P01)

Learn more about PTMs related to CEP290 Recombinant Protein (H00080184-P01).
 

Research Areas for CEP290 Recombinant Protein (H00080184-P01)

Find related products by research area.

Blogs on CEP290.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CEP290 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP290