Recombinant Human CEP290 GST (N-Term) Protein Summary
Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-164 of Human Cep290 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Full Length Recombinant Protein |
Gene |
CEP290 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Theoretical MW |
45.6 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CEP290 GST (N-Term) Protein
Background
This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, CyTOF-ready, IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, PA, AP
Publications for CEP290 Recombinant Protein (H00080184-P01) (0)
There are no publications for CEP290 Recombinant Protein (H00080184-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CEP290 Recombinant Protein (H00080184-P01) (0)
There are no reviews for CEP290 Recombinant Protein (H00080184-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CEP290 Recombinant Protein (H00080184-P01) (0)
Other Available Formats
Additional CEP290 Products
Bioinformatics Tool for CEP290 Recombinant Protein (H00080184-P01)
Discover related pathways, diseases and genes to CEP290 Recombinant Protein (H00080184-P01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CEP290 Recombinant Protein (H00080184-P01)
Discover more about diseases related to CEP290 Recombinant Protein (H00080184-P01).
| | Pathways for CEP290 Recombinant Protein (H00080184-P01)
View related products by pathway.
|
PTMs for CEP290 Recombinant Protein (H00080184-P01)
Learn more about PTMs related to CEP290 Recombinant Protein (H00080184-P01).
| | Research Areas for CEP290 Recombinant Protein (H00080184-P01)
Find related products by research area.
|
Blogs on CEP290.
LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m... Read full blog post.
|