CEP290 Recombinant Protein Antigen

Images

 
There are currently no images for CEP290 Protein (NBP2-33406PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CEP290 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEP290.

Source: E. coli

Amino Acid Sequence: QVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CEP290
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33406.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEP290 Recombinant Protein Antigen

  • BBS14Bardet-Biedl syndrome 14 protein
  • Cancer/testis antigen 87
  • centrosomal protein 290kDa
  • Cep290
  • CT87JBTS6
  • FLJ13615
  • JBTS5CTCL tumor antigen se2-2
  • KIAA0373FLJ21979
  • LCA10monoclonal 3H11 antigen
  • MKS4
  • Nephrocystin-6
  • NPHP6centrosomal protein of 290 kDa
  • POC3 centriolar protein homolog
  • POC3
  • prostate cancer antigen T21
  • rd16,3H11AG
  • SLSN6nephrocytsin-6,3H11Ag
  • Tumor antigen se2-2

Background

CEP290 encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06590
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-88692
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP3-46689
Species: Hu
Applications: ELISA, IHC, IP, WB
NBP3-12211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-14274
Species: Hu
Applications: IHC,  IHC-P
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
NBP2-94059
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-93653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-05035
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-55753
Species: Hu
Applications: IHC,  IHC-P
NBP2-14126
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP3-47705
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP2-56113
Species: Hu
Applications: IHC,  IHC-P
NBP1-88795
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-93637
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00145226-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-92123
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33406PEP
Species: Hu
Applications: AC

Publications for CEP290 Protein (NBP2-33406PEP) (0)

There are no publications for CEP290 Protein (NBP2-33406PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP290 Protein (NBP2-33406PEP) (0)

There are no reviews for CEP290 Protein (NBP2-33406PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CEP290 Protein (NBP2-33406PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CEP290 Products

Array NBP2-33406PEP

Research Areas for CEP290 Protein (NBP2-33406PEP)

Find related products by research area.

Blogs on CEP290.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CEP290 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP290