Centrin 1 Antibody

Images

 
Western Blot: Centrin 1 Antibody [H00001068-D01P] - Analysis of CETN1 expression in mouse kidney.
Western Blot: Centrin 1 Antibody [H00001068-D01P] - Analysis of CETN1 expression in transfected 293T cell line by CETN1 polyclonal antibody.Lane 1: CETN1 transfected lysate(19.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Centrin 1 Antibody Summary

Immunogen
CETN1 (NP_004057.1, 1 a.a. - 172 a.a.) full-length human protein. MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Specificity
CETN1 - centrin, EF-hand protein, 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CETN1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 1 Antibody

  • calcium binding protein
  • Caltractin isoform 2
  • caltractin
  • CEN1centrin-1
  • centrin, EF-hand protein, 1
  • CETN
  • EF-hand protein

Background

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-88213
Species: Hu
Applications: IHC, IHC-P
H00001070-M01
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, RNAi
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88213
Species: Hu
Applications: IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14909
Species: Hu
Applications: WB, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Centrin 1 Antibody (H00001068-D01P) (0)

There are no publications for Centrin 1 Antibody (H00001068-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Centrin 1 Antibody (H00001068-D01P) (0)

There are no reviews for Centrin 1 Antibody (H00001068-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Centrin 1 Antibody (H00001068-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Centrin 1 Products

Bioinformatics Tool for Centrin 1 Antibody (H00001068-D01P)

Discover related pathways, diseases and genes to Centrin 1 Antibody (H00001068-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Centrin 1 Antibody (H00001068-D01P)

View related products by pathway.

PTMs for Centrin 1 Antibody (H00001068-D01P)

Learn more about PTMs related to Centrin 1 Antibody (H00001068-D01P).
 

Research Areas for Centrin 1 Antibody (H00001068-D01P)

Find related products by research area.

Blogs on Centrin 1

There are no specific blogs for Centrin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Centrin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CETN1
Entrez
Uniprot