CDGSH Iron Sulfur Domain 3 Antibody


Western Blot: CDGSH Iron Sulfur Domain 3 Antibody [NBP2-30633] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: A-549
Immunohistochemistry-Paraffin: CDGSH Iron Sulfur Domain 3 Antibody [NBP2-30633] - Staining of human small intestine shows granular like cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CDGSH Iron Sulfur Domain 3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGS
Specificity of human CDGSH Iron Sulfur Domain 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDGSH Iron Sulfur Domain 3 Protein (NBP2-30633PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDGSH Iron Sulfur Domain 3 Antibody

  • CDGSH Iron Sulfur Domain-Containing Protein 3, Mitochondrial
  • CDGSH Iron-Sulfur Domain-Containing Protein 3, Mitochondrial
  • CISD3
  • Miner2
  • MitoNEET Related 2
  • MitoNEET-Related Protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633) (0)

There are no publications for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633) (0)

There are no reviews for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633)

Discover related pathways, diseases and genes to CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CDGSH Iron Sulfur Domain 3

There are no specific blogs for CDGSH Iron Sulfur Domain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDGSH Iron Sulfur Domain 3 Antibody and receive a gift card or discount.


Gene Symbol CISD3