CDGSH Iron Sulfur Domain 3 Antibody

Images

 
Western Blot: CDGSH Iron Sulfur Domain 3 Antibody [NBP2-30633] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: A-549
Immunohistochemistry-Paraffin: CDGSH Iron Sulfur Domain 3 Antibody [NBP2-30633] - Staining of human small intestine shows granular like cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDGSH Iron Sulfur Domain 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CISD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDGSH Iron Sulfur Domain 3 Protein (NBP2-30633PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDGSH Iron Sulfur Domain 3 Antibody

  • CDGSH Iron Sulfur Domain-Containing Protein 3, Mitochondrial
  • CDGSH Iron-Sulfur Domain-Containing Protein 3, Mitochondrial
  • CISD3
  • Miner2
  • MitoNEET Related 2
  • MitoNEET-Related Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-44261
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30918
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633) (0)

There are no publications for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633) (0)

There are no reviews for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDGSH Iron Sulfur Domain 3 Products

Bioinformatics Tool for CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633)

Discover related pathways, diseases and genes to CDGSH Iron Sulfur Domain 3 Antibody (NBP2-30633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CDGSH Iron Sulfur Domain 3

There are no specific blogs for CDGSH Iron Sulfur Domain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDGSH Iron Sulfur Domain 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CISD3
Uniprot