CCDC65 Antibody


Western Blot: CCDC65 Antibody [NBP2-56860] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: CCDC65 Antibody [NBP2-56860] - Staining of human cell line A549 shows localization to vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

CCDC65 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MELEALTKEFETERKTIIDQHEKEIHYLQDIFMAMEQNYIDSEYESKLEFQSMWNDLKNMNLEEKHFLRLHLENRVEDLWRKFQDVLKNYTDAT
Specificity of human CCDC65 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC65 Recombinant Protein Antigen (NBP2-56860PEP)

Reactivity Notes

Mouse 88%, Rat 85%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CCDC65 Antibody

  • coiled-coil domain containing 65
  • coiled-coil domain-containing protein 65
  • FLJ25663
  • FLJ35732
  • NYD-SP28
  • Testis development protein NYD-SP28


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CCDC65 Antibody (NBP2-56860) (0)

There are no publications for CCDC65 Antibody (NBP2-56860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC65 Antibody (NBP2-56860) (0)

There are no reviews for CCDC65 Antibody (NBP2-56860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC65 Antibody (NBP2-56860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CCDC65 Products

Bioinformatics Tool for CCDC65 Antibody (NBP2-56860)

Discover related pathways, diseases and genes to CCDC65 Antibody (NBP2-56860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC65 Antibody (NBP2-56860)

Discover more about diseases related to CCDC65 Antibody (NBP2-56860).

Pathways for CCDC65 Antibody (NBP2-56860)

View related products by pathway.

Blogs on CCDC65

There are no specific blogs for CCDC65, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC65 Antibody and receive a gift card or discount.


Gene Symbol CCDC65