CCDC63 Antibody

Images

 
Western Blot: CCDC63 Antibody [NBP1-91440] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.

Product Details

Summary
Reactivity Hu, Hu, Mu, Rt, Bv, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC63 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human CCDC63. Peptide sequence: EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS
Predicted Species
Human (100%), Mouse (100%), Rat (100%), Guinea Pig (100%), Bovine (93%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC63
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CCDC63 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CCDC63 Antibody

  • coiled-coil domain containing 63
  • FLJ35843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67132
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00023316-M03
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-30249
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NBP2-75411
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCDC63 Antibody (NBP1-91440) (0)

There are no publications for CCDC63 Antibody (NBP1-91440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC63 Antibody (NBP1-91440) (0)

There are no reviews for CCDC63 Antibody (NBP1-91440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC63 Antibody (NBP1-91440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCDC63 Products

Bioinformatics Tool for CCDC63 Antibody (NBP1-91440)

Discover related pathways, diseases and genes to CCDC63 Antibody (NBP1-91440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC63 Antibody (NBP1-91440)

Discover more about diseases related to CCDC63 Antibody (NBP1-91440).

Blogs on CCDC63

There are no specific blogs for CCDC63, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC63
Uniprot