CCDC44 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CCDC44 Antibody [NBP1-88162] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88162] - Staining of human liver.

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88162] - Staining of human kidney, liver, lymph node and testis using Anti-TACO1 antibody NBP1-88162 (A) shows similar protein distribution across tissues to independent antibody NBP1-88160 (B).

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88162] - Staining of human testis.

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88162] - Staining of human lymph node.

Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88162] - Staining of human kidney.

Western Blot: CCDC44 Antibody [NBP1-88162] - Analysis using Anti-TACO1 antibody NBP1-88162 (A) shows similar pattern to independent antibody NBP1-88160 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC44 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEGRGPGGSSLLIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TACO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CCDC44 Protein (NBP1-88162PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCDC44 Antibody - BSA Free

• CCDC44translational activator of cytochrome c oxidase 1
• clone HQ0477 PRO0477p
• coiled-coil domain containing 44
• Coiled-coil domain-containing protein 44
• translational activator of mitochondrially encoded cytochrome c oxidase I
• Translational activator of mitochondrially-encoded cytochrome c oxidase I

Background

TACO1 is a mitochondrial translational activator required for efficient translation of cytochrome c oxidase (COX) subunit I (MTCO1; MIM 516030) (Weraarpachai et al., 2009).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TACO1