CCDC37 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CCDC37 Antibody [NBP2-14449] - Staining in human fallopian tube and prostate tissues using anti-CFAP100 antibody. Corresponding CFAP100 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: CCDC37 Antibody [NBP2-14449] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CCDC37 Antibody [NBP2-14449] - Staining of human prostate shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CCDC37 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: PSANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC37 Protein (NBP2-14449PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC37 Antibody

  • coiled-coil domain containing 37
  • coiled-coil domain-containing protein 37
  • FLJ40083
  • MGC120558

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054360-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
5444-SL
Species: Mu
Applications: BA
NBP2-75090
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
MAB3629
Species: Mu
Applications: IHC
NBP2-82081
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-87780
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-45788
Species: Ce, Hu
Applications: IHC, IHC-P, WB
NBP2-14449
Species: Hu
Applications: IHC

Publications for CCDC37 Antibody (NBP2-14449) (0)

There are no publications for CCDC37 Antibody (NBP2-14449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC37 Antibody (NBP2-14449) (0)

There are no reviews for CCDC37 Antibody (NBP2-14449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC37 Antibody (NBP2-14449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC37 Products

Diseases for CCDC37 Antibody (NBP2-14449)

Discover more about diseases related to CCDC37 Antibody (NBP2-14449).
 

Pathways for CCDC37 Antibody (NBP2-14449)

View related products by pathway.

PTMs for CCDC37 Antibody (NBP2-14449)

Learn more about PTMs related to CCDC37 Antibody (NBP2-14449).

Blogs on CCDC37

There are no specific blogs for CCDC37, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC37