Recombinant Human CCDC28B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CCDC28B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-200 of Human CCDC28B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CCDC28B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCDC28B Protein

  • coiled-coil domain containing 28B
  • coiled-coil domain-containing protein 28B
  • MGC1203
  • MGC16441
  • RP4-622L5.5

Background

The product of this gene localizes to centrosomes and basal bodies. It interacts and colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-88688
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-80848
Species: Hu
Applications: IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-97823
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079140-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CCDC28B Recombinant Protein (H00079140-P01) (0)

There are no publications for CCDC28B Recombinant Protein (H00079140-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC28B Recombinant Protein (H00079140-P01) (0)

There are no reviews for CCDC28B Recombinant Protein (H00079140-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC28B Recombinant Protein (H00079140-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCDC28B Products

Bioinformatics Tool for CCDC28B Recombinant Protein (H00079140-P01)

Discover related pathways, diseases and genes to CCDC28B Recombinant Protein (H00079140-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC28B Recombinant Protein (H00079140-P01)

Discover more about diseases related to CCDC28B Recombinant Protein (H00079140-P01).

Blogs on CCDC28B

There are no specific blogs for CCDC28B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CCDC28B Antibody
NBP2-15747

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCDC28B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC28B