New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

CCDC115 Antibody

Images

 
Western Blot: CCDC115 Antibody [NBP2-87140] - Host: Rabbit. Target Name: CCDC115. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC115 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC115. Peptide sequence: YAMGAKSVGPLQYASHMEPQVCLHASEAQEGLQKFKVVRAGVHAPEEVGP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC115
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC115 Antibody

  • ccp1
  • coiled-coil domain containing 115
  • coiled-coil domain-containing protein 115
  • FLJ30131
  • MGC12981

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83581
Species: Hu
Applications: IHC, IHC-P
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
233-FB/CF
Species: Hu
Applications: BA
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-88263
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-58983
Species: Hu
Applications: IHC, IHC-P, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46502
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-83616
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-35009
Species: Hu
Applications: Func, PAGE, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for CCDC115 Antibody (NBP2-87140) (0)

There are no publications for CCDC115 Antibody (NBP2-87140).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC115 Antibody (NBP2-87140) (0)

There are no reviews for CCDC115 Antibody (NBP2-87140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC115 Antibody (NBP2-87140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC115 Products

Bioinformatics Tool for CCDC115 Antibody (NBP2-87140)

Discover related pathways, diseases and genes to CCDC115 Antibody (NBP2-87140). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC115 Antibody (NBP2-87140)

Discover more about diseases related to CCDC115 Antibody (NBP2-87140).
 

Pathways for CCDC115 Antibody (NBP2-87140)

View related products by pathway.

Blogs on CCDC115

There are no specific blogs for CCDC115, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC115 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC115