CBE1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CBE1 Antibody [NBP2-14425] - Staining in human testis and liver tissues using anti-C9orf24 antibody. Corresponding C9orf24 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CBE1 Antibody [NBP2-14425] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CBE1 Antibody [NBP2-14425] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CBE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C9ORF24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CBE1 Protein (NBP2-14425PEP)
Publications
Read Publication using
NBP2-14425 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBE1 Antibody

  • bA573M23.4
  • C9orf24
  • CBE1
  • chromosome 9 open reading frame 24
  • ciliated bronchial epithelium 1
  • MGC32921
  • MGC33614
  • NYD-SP22
  • SMRP1
  • testes development-related NYD-SP22
  • Testis development protein NYD-SP22

Background

The CBE1 gene was isolated using microarray hybridization to screen for gene expression differences between fetal and adulttestes. The conserved testis development-related genes found in both human and mouse testes may include genes that arelikely to be invol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87928
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DY413
Species: Mu
Applications: ELISA
1129-ER
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-14425
Species: Hu
Applications: IHC

Publications for CBE1 Antibody (NBP2-14425)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CBE1 Antibody (NBP2-14425) (0)

There are no reviews for CBE1 Antibody (NBP2-14425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CBE1 Antibody (NBP2-14425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBE1 Products

Diseases for CBE1 Antibody (NBP2-14425)

Discover more about diseases related to CBE1 Antibody (NBP2-14425).
 

Pathways for CBE1 Antibody (NBP2-14425)

View related products by pathway.

Blogs on CBE1

There are no specific blogs for CBE1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C9ORF24