Home » carabin » carabin Antibodies » carabin Antibody

carabin Antibody

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related carabin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56503
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

carabin Antibody Summary

Immunogen
Synthetic peptides corresponding to TBC1D10C(TBC1 domain family, member 10C) The peptide sequence was selected from the N terminal of TBC1D10C. Peptide sequence MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP.
Predicted Species
Mouse (93%), Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D10C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TBC1D10C and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for carabin Antibody

  • carabin
  • FLJ00332
  • MGC46488
  • TBC1 domain family member 10C
  • TBC1 domain family, member 10C

Background

TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RAB35 Antibody -
Azide Free
NBP2-20042
Western Blot RAB35 Antibody - Azide Free
Western Blot RAB35 Antibody - Azide Free
Immunocytochemistry/ Immunofluorescence RAB35 Antibody - Azide Free
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
ERK1 [p Thr202, p
Tyr204] [Biotin]
DYC1825-2
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
(12 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
TBC1D10A Antibody
- BSA Free
NBP2-36551
Western Blot TBC1D10A Antibody - BSA Free
Immunoprecipitation TBC1D10A Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
KCNN3 Antibody -
BSA Free
NBP2-85137
Immunohistochemistry-Paraffin KCNN3 Antibody - BSA Free
Western Blot KCNN3 Antibody - BSA Free
Western Blot KCNN3 Antibody - BSA Free
Species: Hu, Pm, Mu
Applications: IHC,  IHC-P, WB
MCM8 Antibody -
BSA Free
NBP2-55276
Immunocytochemistry/ Immunofluorescence MCM8 Antibody - BSA Free
Western Blot MCM8 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
ZHX2 Antibody -
BSA Free
NBP1-82956
Immunocytochemistry/ Immunofluorescence ZHX2 Antibody - BSA Free
Immunohistochemistry-Paraffin ZHX2 Antibody - BSA Free
Immunohistochemistry-Paraffin ZHX2 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(160 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
ZDHHC2 Antibody -
BSA Free
NBP2-13541
Simple Western ZDHHC2 Antibody - BSA Free
Simple Western ZDHHC2 Antibody - BSA Free
Immunohistochemistry-Paraffin ZDHHC2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: IHC,  IHC-P, Simple Western, WB
RhoD Antibody -
BSA Free
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody - BSA Free
Western Blot RhoD Antibody - BSA Free
Immunohistochemistry RhoD Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
Rhodopsin Antibody
(B630) - BSA Free
NBP2-25160
Immunohistochemistry Rhodopsin Antibody (B630) - BSA Free
Western Blot Rhodopsin Antibody (B630) - BSA Free
Immunocytochemistry/ Immunofluorescence Rhodopsin Antibody (B630) - BSA Free
(11 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(389 Publications)
Species: Hu
Applications: BA
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(67 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
carabin Antibody
NBP1-56503
carabin Antibody
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp
Applications: WB

Publications for carabin Antibody (NBP1-56503) (0)

There are no publications for carabin Antibody (NBP1-56503).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for carabin Antibody (NBP1-56503) (0)

There are no reviews for carabin Antibody (NBP1-56503). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for carabin Antibody (NBP1-56503) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional carabin Products

Research Areas for carabin Antibody (NBP1-56503)

Find related products by research area.

Blogs on carabin

There are no specific blogs for carabin, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our carabin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TBC1D10C
Uniprot