Home » Calpain 9 » Calpain 9 Proteins » Calpain 9 Recombinant Protein Antigen

Calpain 9 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Calpain 9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Calpain 9.

Source: E. coli

Amino Acid Sequence: PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAPN9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48545.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Calpain 9 Recombinant Protein Antigen

  • calpain 9 (nCL-4)
  • calpain 9
  • calpain-9
  • Digestive tract-specific calpain
  • EC 3.4.22
  • EC 3.4.22.54
  • GC36
  • NCL4
  • nCL-4EC 3.4.22.-
  • New calpain 4
  • novel calpain large subunit-4
  • Protein CG36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Calpastatin
Antibody (OTI1E7)
NBP2-01819
Western Blot: Calpastatin Antibody (1E7) [NBP2-01819] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Calpastatin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Calpastatin.
Immunohistochemistry-Paraffin: Calpastatin Antibody (1E7) [NBP2-01819] Staining of paraffin-embedded Human prostate tissue using anti-Calpastatin mouse monoclonal antibody.
Flow Cytometry: Calpastatin Antibody (1E7) [NBP2-01819] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Calpastatin antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Calpain 1 Antibody
(107-82)
NB120-3588
Immunocytochemistry/Immunofluorescence: Calpain 1 Antibody (107-82) [NB120-3588] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a M-Calpain monoclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunocytochemistry/Immunofluorescence: Calpain 1 Antibody (107-82) [NB120-3588] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a M-Calpain monoclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunocytochemistry/Immunofluorescence: Calpain 1 Antibody (107-82) [NB120-3588] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a M-Calpain monoclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
(1 Review)
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
CEACAM/CD66
Antibody (COL-1)
NBP2-29454
Western Blot: CEACAM/CD66 Antibody (COL-1) [NBP2-29454] - Analysis of CEA in human stomach lysate using CEA antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: CEACAM/CD66 Antibody (COL-1) [NBP2-29454] - Staining of colon cancer.
Flow (Intracellular): CEACAM/CD66 Antibody (COL-1) [NBP2-29454] - An intracellular stain was performed on A549 cells with CEACAM/CD66 Antibody (COL-1) NBP2-33306PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin. Image using the PE format of this antibody.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CAPN8 Antibody
NBP2-56622
Immunocytochemistry/Immunofluorescence: CAPN8 Antibody [NBP2-56622] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear membrane & vesicles.
Species: Hu
Applications: ICC/IF
Calpain 1 Antibody
(107-82)
NB120-3588
Immunocytochemistry/Immunofluorescence: Calpain 1 Antibody (107-82) [NB120-3588] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a M-Calpain monoclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunocytochemistry/Immunofluorescence: Calpain 1 Antibody (107-82) [NB120-3588] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a M-Calpain monoclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunocytochemistry/Immunofluorescence: Calpain 1 Antibody (107-82) [NB120-3588] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a M-Calpain monoclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
(1 Review)
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Calpain 3 Antibody
NBP1-31756
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF
Gastrokine 1
Antibody
AF7287
Western blot shows lysates of mouse stomach tissue and rat stomach tissue. PVDF membrane was probed with 0.1 µg/mL of Sheep Anti-Human/Mouse Gastrokine 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7287) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Gastrokine 1 at approximately 18-20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Gastrokine 1 was detected in immersion fixed paraffin-embedded sections of human stomach using Sheep Anti-Mouse Gastrokine 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7287) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to islets. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Gastrokine 1 was detected in perfusion fixed frozen sections of mouse stomach using Sheep Anti-Mouse Gastrokine 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7287) at 15 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to islets. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Hu, Mu
Applications: WB, IHC
Calpain 3 Antibody
NBP1-31756
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF
CA11
Overexpression Lysate
NBL1-08611
Western Blot: CA11 Overexpression Lysate (Adult Normal) [NBL1-08611] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for CA11.
Species: Hu
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(1 Publication)
Species: Hu
Calpain 13 Antibody
NBP2-14435
Immunohistochemistry-Paraffin: Calpain 13 Antibody [NBP2-14435] - Staining of human bronchus shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Calpain 2 Antibody
NBP1-88204
Western Blot: Calpain 2 Antibody [NBP1-88204] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: Calpain 2 Antibody [NBP1-88204] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Calpain 2 Antibody [NBP1-88204] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
B-Raf Antibody
(OTI5A9)
NBP1-47668
Western Blot: B-Raf Antibody (OTI5A9) [NBP1-47668] - Analysis of extracts (35ug) from 9 different cell lines by using anti-B Raf monoclonal antibody.
Immunocytochemistry/Immunofluorescence: B-Raf Antibody (OTI5A9) [NBP1-47668] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY B Raf.
Immunohistochemistry-Paraffin: B-Raf Antibody (OTI5A9) [NBP1-47668] - Staining of paraffin-embedded Human pancreas tissue using anti-B Raf mouse monoclonal antibody.
(1 Publication)
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
COG3 Antibody
NBP2-15937
Western Blot: COG3 Antibody [NBP2-15937] - Sample (50 ug of whole cell lysate) A: mosue testis, 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: COG3 Antibody [NBP2-15937] - Immunohistochemical analysis of paraffin-embedded Hepatoma, using antibody at 1:500 dilution.
Western Blot: COG3 Antibody [NBP2-15937] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa 7. 5% SDS PAGE gel, diluted at 1:2000.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
Flow (Intracellular): NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on THP-1 cells with NOD2 (2D9) antibody NB100-524AF488 (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Dystonin Antibody
NBP1-89946
Immunocytochemistry/Immunofluorescence: Dystonin Antibody [NBP1-89946] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dystonin Antibody [NBP1-89946] - Staining of human tonsil shows low positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Dystonin Antibody [NBP1-89946] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP) (0)

There are no publications for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP) (0)

There are no reviews for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Calpain 9 Products

Bioinformatics Tool for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP)

Discover related pathways, diseases and genes to Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP)

Discover more about diseases related to Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP).
 

Pathways for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP)

View related products by pathway.

PTMs for Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP)

Learn more about PTMs related to Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP).

Blogs on Calpain 9

There are no specific blogs for Calpain 9, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
NOD2 Antibody (2D9)
NB100-524

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calpain 9 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CAPN9