Calpain 15 Antibody (2H7)

Images

 
Sandwich ELISA: Calpain 15 Antibody (2H7) [H00006650-M09] - Detection limit for recombinant GST tagged SOLH is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calpain 15 Antibody (2H7) Summary

Immunogen
SOLH (NP_005623, 993 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Specificity
SOLH - small optic lobes homolog (Drosophila) (2H7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOLH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain 15 Antibody (2H7)

  • calpain-15
  • CAPN15Small optic lobes homolog
  • EC 3.4.22
  • EC 3.4.22.-
  • EC 3.4.22.54
  • MGC131491
  • small optic lobes (Drosophila) homolog
  • small optic lobes homolog (Drosophila)

Background

This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81628
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-56661
Species: Hu
Applications: ICC/IF, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
AF5077
Species: Hu
Applications: WB
NBP1-84378
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-00221
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF5315
Species: Hu, Mu
Applications: WB
H00000487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Calpain 15 Antibody (H00006650-M09) (0)

There are no publications for Calpain 15 Antibody (H00006650-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 15 Antibody (H00006650-M09) (0)

There are no reviews for Calpain 15 Antibody (H00006650-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calpain 15 Antibody (H00006650-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain 15 Products

Bioinformatics Tool for Calpain 15 Antibody (H00006650-M09)

Discover related pathways, diseases and genes to Calpain 15 Antibody (H00006650-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 15 Antibody (H00006650-M09)

Discover more about diseases related to Calpain 15 Antibody (H00006650-M09).
 

Pathways for Calpain 15 Antibody (H00006650-M09)

View related products by pathway.

PTMs for Calpain 15 Antibody (H00006650-M09)

Learn more about PTMs related to Calpain 15 Antibody (H00006650-M09).
 

Research Areas for Calpain 15 Antibody (H00006650-M09)

Find related products by research area.

Blogs on Calpain 15

There are no specific blogs for Calpain 15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain 15 Antibody (2H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOLH
Entrez
Uniprot