CALML4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CALML4 Antibody [NBP2-14434] - Immunofluorescent staining of human cell line HEK 293 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: CALML4 Antibody [NBP2-14434] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CALML4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGK VKYDEFIHKITLPGRDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALML4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CALML4 Protein (NBP2-14434PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CALML4 Antibody

  • calmodulin-like protein 4
  • calmodulin-like 4
  • NY-BR-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
NBP1-86156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-14131
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14434
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CALML4 Antibody (NBP2-14434) (0)

There are no publications for CALML4 Antibody (NBP2-14434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML4 Antibody (NBP2-14434) (0)

There are no reviews for CALML4 Antibody (NBP2-14434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CALML4 Antibody (NBP2-14434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CALML4 Products

Bioinformatics Tool for CALML4 Antibody (NBP2-14434)

Discover related pathways, diseases and genes to CALML4 Antibody (NBP2-14434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALML4 Antibody (NBP2-14434)

Discover more about diseases related to CALML4 Antibody (NBP2-14434).

Blogs on CALML4

There are no specific blogs for CALML4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CALML4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALML4