CALML4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CALML4 Antibody [NBP2-14434] - Staining of human cell line HEK 293 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CALML4 Antibody [NBP2-14434] - Staining in human small intestine and skeletal muscle tissues using anti-CALML4 antibody. Corresponding CALML4 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: CALML4 Antibody [NBP2-14434] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CALML4 Antibody [NBP2-14434] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CALML4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALML4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CALML4 Protein (NBP2-14434PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CALML4 Antibody

  • calmodulin-like protein 4
  • calmodulin-like 4
  • NY-BR-20

Background

CALML4 is a gene that codes for a protein expressed in breast cancer cell lines that has four isoforms, which have lengths of 196, 120, 81, and 149 amino acids and weights of approximately 22, 14, 9, and 17 kDa respectively. Current studies are being done on diseases and disorders linked to this gene including breast cancer and gout.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-92323
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56150
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC, IHC-P, WB
NBP1-86156
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00051765-M02
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-14131
Species: Hu
Applications: IHC, IHC-P
NBP3-03930
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14434
Species: Hu
Applications: ICC/IF, IHC

Publications for CALML4 Antibody (NBP2-14434) (0)

There are no publications for CALML4 Antibody (NBP2-14434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML4 Antibody (NBP2-14434) (0)

There are no reviews for CALML4 Antibody (NBP2-14434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CALML4 Antibody (NBP2-14434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CALML4 Products

Diseases for CALML4 Antibody (NBP2-14434)

Discover more about diseases related to CALML4 Antibody (NBP2-14434).

Blogs on CALML4

There are no specific blogs for CALML4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CALML4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALML4