CACNA2D1 Recombinant Protein Antigen

Images

 
There are currently no images for CACNA2D1 Protein (NBP1-86682PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CACNA2D1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA2D1.

Source: E. coli

Amino Acid Sequence: QFLLSLTFPRLLEAVEMEDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHGEKLMNTNLIFIMVESKGTCPCDTRLLIQAEQTSDGPNPCDMVKQPRYRKGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA2D1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86682.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CACNA2D1 Recombinant Protein Antigen

  • CACNA2
  • CACNA2D1
  • CACNL2A
  • CACNL2Adihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit
  • calcium channel, L type, alpha 2 polypeptide
  • calcium channel, voltage-dependent, alpha 2/delta subunit 1
  • CCHL2A
  • MHS3
  • voltage-dependent calcium channel subunit alpha-2/delta-1
  • Voltage-gated calcium channel subunit alpha-2/delta-1

Background

The CACNA2D1 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-1 protein that exists in 5 isoforms: isoform 1: 1,103 amino acids long, 124 kDA; isoform 2: 1,091 amino acids long, 123 kDA; isoform 3: 1,086 amino acids long, 122 kDA; isoform 4: 1,079 amino acids long, 121 kDA; and isoform 5: 1,084 amino acids long, 122 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function in excitation-contraction coupling. The CACNA2D1 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, MAPK signaling pathway, and cardiac muscle contraction. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D1 gene is associated with neuroblastoma, heart blocks, liver disease, parkinson's disease, dementia, malignant hyperthermia susceptibility, lambert-eaton myasthenic syndrome, timothy syndrome, peripheral neropathy, and fatty liver disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-81501
Species: Hu, Rt
Applications: IHC,  IHC-P, KD
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
H00000783-M05
Species: Hu, Mu
Applications: ELISA, WB
NBP2-12893
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-30557
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-77097
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB300-542
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr,  IHC-P, IP, WB
NB110-2546
Species: Hu, Mu
Applications: Flow, AP, IA, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-44945
Species: Hu, Mu
Applications: WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, KD, WB

Publications for CACNA2D1 Protein (NBP1-86682PEP) (0)

There are no publications for CACNA2D1 Protein (NBP1-86682PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA2D1 Protein (NBP1-86682PEP) (0)

There are no reviews for CACNA2D1 Protein (NBP1-86682PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CACNA2D1 Protein (NBP1-86682PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNA2D1 Products

Blogs on CACNA2D1

There are no specific blogs for CACNA2D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CACNA2D1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA2D1