BTBD6 Antibody

Images

 
Western Blot: BTBD6 Antibody [NBP1-88672] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: BTBD6 Antibody [NBP1-88672] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BTBD6 Antibody [NBP1-88672] - Staining of human eye shows strong positivity in the lens.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WEVIDAQAEMALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPITPRNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEETHSIFLWYTATNKPRLDFPLTKRKGLAPQRCHRFQSSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTBD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTBD6 Protein (NBP1-88672PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD6 Antibody

  • BDPLBTB domain protein BDPL
  • BTB (POZ) domain containing 6
  • BTB/POZ domain-containing protein 6
  • glucocorticoid receptor AF-1 coactivator-1
  • Lens BTB domain protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP2-38069
Species: Hu
Applications: IHC, IHC-P
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-81496
Species: Hu
Applications: IHC, IHC-P
NBP1-92208
Species: Hu
Applications: IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-2859
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for BTBD6 Antibody (NBP1-88672) (0)

There are no publications for BTBD6 Antibody (NBP1-88672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD6 Antibody (NBP1-88672) (0)

There are no reviews for BTBD6 Antibody (NBP1-88672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BTBD6 Antibody (NBP1-88672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTBD6 Products

Bioinformatics Tool for BTBD6 Antibody (NBP1-88672)

Discover related pathways, diseases and genes to BTBD6 Antibody (NBP1-88672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD6 Antibody (NBP1-88672)

Discover more about diseases related to BTBD6 Antibody (NBP1-88672).

Blogs on BTBD6

There are no specific blogs for BTBD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTBD6