BTAF1 Antibody [Biotin]

Product Discontinued

BTAF1 Antibody [Biotin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1).
  
  Sequence:
  LAVQNSSLHDIQHAPKLSALKQLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTAF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for BTAF1 Antibody [Biotin]

• ATP-dependent helicase BTAF1
• BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae)
• B-TFIID transcription factor-associated 170 kDa subunit
• EC 3.6.1
• EC 3.6.4.-
• MOT1MGC138406
• TAF(II)170KIAA0940
• TAF-172
• TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae)
• TAFII170TATA-binding protein-associated factor 172
• TBP-associated factor 172

Background

BTAF1 is a member of the SNF2-like family of ATPases that associates with the TATA-binding protein (TBP) and TAFII170 (TAF172) to form the B-TF-IID complex. As part of the general transcription machinery, BTAF1 acts as a regulator of TBP and RNA polymerase II transcription. Alternate names for BTAF1 include BTAF-1, RNA polymerase II, B-TFIID transcription factor-associated, 170kDa, TAF172, TBP-associated factor 172, TAFII170, B-TFIID transcription factor-associated, 170kDa, and MOT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTAF1