BRUNOL6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BRUNOL6 Antibody [NBP2-31562] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: BRUNOL6 Antibody [NBP2-31562] - Staining of human testis shows distinct positivity in spermatozoa.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRUNOL6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PRLGFSTADSGVGMSGLNPGPAVPMKDHDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CELF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRUNOL6 Protein (NBP2-31562PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRUNOL6 Antibody

  • Bruno (Drosophila) -like 6, RNA binding protein
  • Bruno -like 6, RNA binding protein
  • BRUNOL6bruno-like 6, RNA binding protein (Drosophila)
  • bruno-like 6, RNA binding protein
  • Bruno-like protein 6
  • CELF-6
  • CUG-BP and ETR-3 like factor 6
  • CUG-BP- and ETR-3-like factor 6
  • CUGBP Elav-like family member 6
  • CUGBP, Elav-like family member 6
  • RNA-binding protein BRUNOL-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
MAB6237
Species: Hu
Applications: WB, IHC
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87333
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55039
Species: Hu
Applications: WB
NBP2-31562
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for BRUNOL6 Antibody (NBP2-31562) (0)

There are no publications for BRUNOL6 Antibody (NBP2-31562).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRUNOL6 Antibody (NBP2-31562) (0)

There are no reviews for BRUNOL6 Antibody (NBP2-31562). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRUNOL6 Antibody (NBP2-31562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRUNOL6 Products

Bioinformatics Tool for BRUNOL6 Antibody (NBP2-31562)

Discover related pathways, diseases and genes to BRUNOL6 Antibody (NBP2-31562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BRUNOL6

There are no specific blogs for BRUNOL6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRUNOL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELF6
Uniprot