BRUNOL6 Antibody

Immunocytochemistry/Immunofluorescence: BRUNOL6 Antibody [NBP2-31562] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: BRUNOL6 Antibody [NBP2-31562] - Staining of human testis shows distinct positivity in spermatozoa.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BRUNOL6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PRLGFSTADSGVGMSGLNPGPAVPMKDHDA
• Predicted Species: Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CELF6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BRUNOL6 Protein (NBP2-31562PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BRUNOL6 Antibody

• Bruno (Drosophila) -like 6, RNA binding protein
• Bruno -like 6, RNA binding protein
• BRUNOL6bruno-like 6, RNA binding protein (Drosophila)
• bruno-like 6, RNA binding protein
• Bruno-like protein 6
• CELF-6
• CUG-BP and ETR-3 like factor 6
• CUG-BP- and ETR-3-like factor 6
• CUGBP Elav-like family member 6
• CUGBP, Elav-like family member 6
• RNA-binding protein BRUNOL-6

Background

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CELF6
• Uniprot:
  • Q96J87(Human)