PARP6 Antibody

Images

 
Western Blot: PARP6 Antibody [NBP2-85443] - Host: Rabbit. Target Name: PARP6. Sample Type: Human MCF7. Antibody Dilution: 1.0ug/mlPARP6 is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: PARP6 Antibody [NBP2-85443] - WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: 721_B cell lysate
Western Blot: PARP6 Antibody [NBP2-85443] - Host: Rabbit. Target Name: PARP6. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: PARP6 Antibody [NBP2-85443] - Host: Rabbit. Target Name: PARP6. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human PARP6. Peptide sequence: MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Zebrafish (100%), Bovine (100%), Equine (100%), Canine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
PARP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARP6 Antibody

  • EC 2.4.2.30
  • MGC131971
  • PARP-6
  • pART17
  • poly (ADP-ribose) polymerase family, member 6
  • poly [ADP-ribose] polymerase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31562
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-31415
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47337
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37505
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB100-1162
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-85443
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for PARP6 Antibody (NBP2-85443) (0)

There are no publications for PARP6 Antibody (NBP2-85443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP6 Antibody (NBP2-85443) (0)

There are no reviews for PARP6 Antibody (NBP2-85443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP6 Antibody (NBP2-85443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PARP6 Products

Bioinformatics Tool for PARP6 Antibody (NBP2-85443)

Discover related pathways, diseases and genes to PARP6 Antibody (NBP2-85443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP6 Antibody (NBP2-85443)

Discover more about diseases related to PARP6 Antibody (NBP2-85443).
 

Pathways for PARP6 Antibody (NBP2-85443)

View related products by pathway.

Research Areas for PARP6 Antibody (NBP2-85443)

Find related products by research area.

Blogs on PARP6

There are no specific blogs for PARP6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP6