PARP6 Antibody

Western Blot: PARP6 Antibody [NBP2-85443] - Host: Rabbit. Target Name: PARP6. Sample Type: Human MCF7. Antibody Dilution: 1.0ug/mlPARP6 is supported by BioGPS gene expression data to be expressed in MCF7

Western Blot: PARP6 Antibody [NBP2-85443] - WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: 721_B cell lysate

Western Blot: PARP6 Antibody [NBP2-85443] - Host: Rabbit. Target Name: PARP6. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

Western Blot: PARP6 Antibody [NBP2-85443] - Host: Rabbit. Target Name: PARP6. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PARP6 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PARP6. Peptide sequence: MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PARP6 Antibody

• ARTD17
• EC 2.4.2.30
• MGC131971
• PARP6
• PARP-6
• pART17
• poly (ADP-ribose) polymerase family, member 6
• poly [ADP-ribose] polymerase 6

Background

Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition of multiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to glu/asp residues onthe substrate protein, and also polymerizes ADP-ribose to form long/branched chain polymers. PARP inhibitors are beingdeveloped for use in a number of pathologies including cancer, diabetes, stroke and cardiovascular disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARP6