PARP6 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human PARP6. Peptide sequence: MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PARP6 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PARP6 Antibody
Background
Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition of multiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to glu/asp residues onthe substrate protein, and also polymerizes ADP-ribose to form long/branched chain polymers. PARP inhibitors are beingdeveloped for use in a number of pathologies including cancer, diabetes, stroke and cardiovascular disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Publications for PARP6 Antibody (NBP2-85443) (0)
There are no publications for PARP6 Antibody (NBP2-85443).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PARP6 Antibody (NBP2-85443) (0)
There are no reviews for PARP6 Antibody (NBP2-85443).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PARP6 Antibody (NBP2-85443) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PARP6 Products
Bioinformatics Tool for PARP6 Antibody (NBP2-85443)
Discover related pathways, diseases and genes to PARP6 Antibody (NBP2-85443). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PARP6 Antibody (NBP2-85443)
Discover more about diseases related to PARP6 Antibody (NBP2-85443).
| | Pathways for PARP6 Antibody (NBP2-85443)
View related products by pathway.
|
Research Areas for PARP6 Antibody (NBP2-85443)
Find related products by research area.
|
Blogs on PARP6