BRUNOL5 Antibody - BSA Free

Immunohistochemistry-Paraffin: BRUNOL5 Antibody [NBP2-34134] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: BRUNOL5 Antibody [NBP2-34134] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: BRUNOL5 Antibody [NBP2-34134] - Staining in human cerebral cortex and pancreas tissues using anti-CELF5 antibody. Corresponding CELF5 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRUNOL5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BRUNOL5 Antibody - BSA Free (NBP2-34134) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQ
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CELF5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BRUNOL5 Protein (NBP2-34134PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BRUNOL5 Antibody - BSA Free

• Bruno (Drosophila) -like 5, RNA binding protein
• BRUNOL-5
• BRUNOL5bruno-like 5, RNA binding protein (Drosophila)
• bruno-like 5 RNA binding protein
• Bruno-like protein 5
• CELF-5
• CUG-BP and ETR-3 like factor 5
• CUG-BP- and ETR-3-like factor 5
• CUGBP Elav-like family member 5
• CUGBP, Elav-like family member 5
• RNA-binding protein BRUNOL-5

Background

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CELF5
• Uniprot:
  • Q8N6W0(Human)