BRUNOL5 Antibody


Immunohistochemistry-Paraffin: BRUNOL5 Antibody [NBP1-89931] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: BRUNOL5 Antibody [NBP1-89931] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: BRUNOL5 Antibody [NBP1-89931] - Staining in human cerebral cortex and lymph node tissues using anti-CELF5 antibody. Corresponding CELF5 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

BRUNOL5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYAN
Specificity of human BRUNOL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BRUNOL5 Protein (NBP1-89931PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BRUNOL5 Antibody

  • Bruno (Drosophila) -like 5, RNA binding protein
  • BRUNOL-5
  • BRUNOL5bruno-like 5, RNA binding protein (Drosophila)
  • bruno-like 5 RNA binding protein
  • Bruno-like protein 5
  • CELF-5
  • CUG-BP and ETR-3 like factor 5
  • CUG-BP- and ETR-3-like factor 5
  • CUGBP Elav-like family member 5
  • CUGBP, Elav-like family member 5
  • RNA-binding protein BRUNOL-5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for BRUNOL5 Antibody (NBP1-89931) (0)

There are no publications for BRUNOL5 Antibody (NBP1-89931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRUNOL5 Antibody (NBP1-89931) (0)

There are no reviews for BRUNOL5 Antibody (NBP1-89931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BRUNOL5 Antibody (NBP1-89931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRUNOL5 Products

Bioinformatics Tool for BRUNOL5 Antibody (NBP1-89931)

Discover related pathways, diseases and genes to BRUNOL5 Antibody (NBP1-89931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for BRUNOL5 Antibody (NBP1-89931)

View related products by pathway.

Blogs on BRUNOL5

There are no specific blogs for BRUNOL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRUNOL5 Antibody and receive a gift card or discount.


Gene Symbol CELF5