BRUNOL5 Antibody

Images

 
Western Blot: BRUNOL5 Antibody [NBP1-57520] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRUNOL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to BRUNOL5 (CUGBP, Elav-like family member 5) The peptide sequence was selected from the middle region of BRUNOL5)(50ug). Peptide sequence GVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CELF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BRUNOL5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BRUNOL5 Antibody

  • Bruno (Drosophila) -like 5, RNA binding protein
  • BRUNOL-5
  • BRUNOL5bruno-like 5, RNA binding protein (Drosophila)
  • bruno-like 5 RNA binding protein
  • Bruno-like protein 5
  • CELF-5
  • CUG-BP and ETR-3 like factor 5
  • CUG-BP- and ETR-3-like factor 5
  • CUGBP Elav-like family member 5
  • CUGBP, Elav-like family member 5
  • RNA-binding protein BRUNOL-5

Background

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16035
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89932
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
H00002027-M01
Species: Hu, Bv
Applications: WB, DB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-89933
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57520
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for BRUNOL5 Antibody (NBP1-57520) (0)

There are no publications for BRUNOL5 Antibody (NBP1-57520).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRUNOL5 Antibody (NBP1-57520) (0)

There are no reviews for BRUNOL5 Antibody (NBP1-57520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRUNOL5 Antibody (NBP1-57520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BRUNOL5 Products

Bioinformatics Tool for BRUNOL5 Antibody (NBP1-57520)

Discover related pathways, diseases and genes to BRUNOL5 Antibody (NBP1-57520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for BRUNOL5 Antibody (NBP1-57520)

View related products by pathway.

Blogs on BRUNOL5

There are no specific blogs for BRUNOL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRUNOL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELF5
Uniprot