Recombinant Human BRN4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BRN4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 361 of Human POU3F4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
POU3F4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRN4 Protein

  • brain-specific homeobox/POU domain protein 4
  • octamer-binding transcription factor 9
  • OTF9
  • POU class 3 homeobox 4
  • POU domain, class 3, transcription factor 4

Background

This gene encodes a member of the POU-III class of neural transcription factors. This gene may play a role in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations have been associated with X chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-49872
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP2-58020
Species: Hu
Applications: ICC/IF
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-46076
Species: Hu
Applications: WB, IHC
AF3444
Species: Hu
Applications: WB
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NBP1-31654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF6014
Species: Hu, Mu, Rt
Applications: WB
H00005456-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for BRN4 Recombinant Protein (H00005456-P01) (0)

There are no publications for BRN4 Recombinant Protein (H00005456-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN4 Recombinant Protein (H00005456-P01) (0)

There are no reviews for BRN4 Recombinant Protein (H00005456-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN4 Recombinant Protein (H00005456-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRN4 Products

Bioinformatics Tool for BRN4 Recombinant Protein (H00005456-P01)

Discover related pathways, diseases and genes to BRN4 Recombinant Protein (H00005456-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN4 Recombinant Protein (H00005456-P01)

Discover more about diseases related to BRN4 Recombinant Protein (H00005456-P01).
 

Pathways for BRN4 Recombinant Protein (H00005456-P01)

View related products by pathway.

PTMs for BRN4 Recombinant Protein (H00005456-P01)

Learn more about PTMs related to BRN4 Recombinant Protein (H00005456-P01).

Blogs on BRN4

There are no specific blogs for BRN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRN4 Antibody
NBP1-89934
Pax6 Antibody
NB300-750

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRN4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F4