BRN4 Recombinant Protein Antigen

Images

 
There are currently no images for BRN4 Protein (NBP1-89934PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BRN4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POU3F4.

Source: E.coli

Amino Acid Sequence: RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POU3F4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89934.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BRN4 Recombinant Protein Antigen

  • brain-specific homeobox/POU domain protein 4
  • octamer-binding transcription factor 9
  • OTF9
  • POU class 3 homeobox 4
  • POU domain, class 3, transcription factor 4

Background

BRN4 encodes a member of the POU-III class of neural transcription factors. This gene may play a role in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations have been associated with X chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21585
Species: Pm, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-49872
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP3-13349
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF2419
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3444
Species: Hu
Applications: IHC, WB
H00002707-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NBP2-13813
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP1-84079
Species: Hu
Applications: IHC, IHC-P, WB

Publications for BRN4 Protein (NBP1-89934PEP) (0)

There are no publications for BRN4 Protein (NBP1-89934PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN4 Protein (NBP1-89934PEP) (0)

There are no reviews for BRN4 Protein (NBP1-89934PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRN4 Protein (NBP1-89934PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRN4 Products

Bioinformatics Tool for BRN4 Protein (NBP1-89934PEP)

Discover related pathways, diseases and genes to BRN4 Protein (NBP1-89934PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN4 Protein (NBP1-89934PEP)

Discover more about diseases related to BRN4 Protein (NBP1-89934PEP).
 

Pathways for BRN4 Protein (NBP1-89934PEP)

View related products by pathway.

PTMs for BRN4 Protein (NBP1-89934PEP)

Learn more about PTMs related to BRN4 Protein (NBP1-89934PEP).

Blogs on BRN4

There are no specific blogs for BRN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRN4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F4