BPIFB4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

BPIFB4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BPIFB4
  
  

  Source: E.coli

  Amino Acid Sequence: PKDLETTICLIDVDTELLASFSIEGDKLMIDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BPIFB4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24699It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BPIFB4 Recombinant Protein Antigen

• BPI fold containing family B, member 4
• BPI fold-containing family B member 4
• dJ726C3.5
• ligand-binding protein RY2G5
• likely ortholog of rat probable ligand-binding protein RY2G5
• long palate, lung and nasal epithelium carcinoma associated 4
• LPLUNC4
• lung and nasal epithelium carcinoma-associated protein 4
• RY2G5

Background

C20orf186 may have the capacity to recognize and bind specific classes of odorants. May act as a carrier molecule,transporting odorants across the mucus layer to access receptor sites. May serve as a primary defense mechanism byrecognizing and removing potentially

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BPIFB4