BCNP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BCNP Antibody [NBP1-90771] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: BCNP Antibody [NBP1-90771] - Staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCNP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HKEEYENGGHCLGSTALTGYTLLTSQREYLRLLDALCPESLGDHTQEEPDSLLEVPVSFPLFLQHPFRRHLCFSAATR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM129C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BCNP Protein (NBP1-90771PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCNP Antibody

  • B-cell novel protein 1
  • BCNP1
  • family with sequence similarity 129, member C
  • FLJ39802
  • niban-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-651
Species: Hu
Applications: WB
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45641
Species: Hu
Applications: WB, IHC
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF8005
Species: Hu
Applications: WB

Publications for BCNP Antibody (NBP1-90771) (0)

There are no publications for BCNP Antibody (NBP1-90771).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCNP Antibody (NBP1-90771) (0)

There are no reviews for BCNP Antibody (NBP1-90771). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BCNP Antibody (NBP1-90771) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCNP Products

BCNP NBP1-90771

Bioinformatics Tool for BCNP Antibody (NBP1-90771)

Discover related pathways, diseases and genes to BCNP Antibody (NBP1-90771). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCNP Antibody (NBP1-90771)

Discover more about diseases related to BCNP Antibody (NBP1-90771).
 

Pathways for BCNP Antibody (NBP1-90771)

View related products by pathway.

Blogs on BCNP

There are no specific blogs for BCNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCNP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM129C