Recombinant Human BAT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BAT2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2046-2145 of Human BAT2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FQDYQKLSSNLGGPGSSRTPPTGRSFSGLNSRLKATPSTYSGVFRTQRVDLYQQASPPDALRWIPKPWERTGLPPREGPSRRAEEPGSRGDKEPGLPPPR

Protein/Peptide Type
Partial Recombinant Protein
Gene
PRRC2A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAT2 Protein

  • BAT2DKFZp686D09175
  • D6S51ED6S51
  • G2HLA-B-associated transcript 2
  • HLA-B associated transcript 2
  • Large proline-rich protein BAT2
  • Proline-rich and coiled-coil-containing protein 2A
  • proline-rich coiled-coil 2A
  • Protein G2

Background

A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. This gene has microsatellite repeats which are associated with the age-at-onset of insulin-dependent diabetes mellitus (IDDM) and possibly thought to be involved with the inflammatory process of pancreatic beta-cell destruction during the development of IDDM. This gene is also a candidate gene for the development of rheumatoid arthritis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-52455
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16134
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
H00005544-R02
Species: Hu
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01826
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
NBP2-15548
Species: Hu
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready

Publications for BAT2 Partial Recombinant Protein (H00007916-Q01) (0)

There are no publications for BAT2 Partial Recombinant Protein (H00007916-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAT2 Partial Recombinant Protein (H00007916-Q01) (0)

There are no reviews for BAT2 Partial Recombinant Protein (H00007916-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAT2 Partial Recombinant Protein (H00007916-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAT2 Products

BAT2 H00007916-Q01

Bioinformatics Tool for BAT2 Partial Recombinant Protein (H00007916-Q01)

Discover related pathways, diseases and genes to BAT2 Partial Recombinant Protein (H00007916-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAT2 Partial Recombinant Protein (H00007916-Q01)

Discover more about diseases related to BAT2 Partial Recombinant Protein (H00007916-Q01).
 

Pathways for BAT2 Partial Recombinant Protein (H00007916-Q01)

View related products by pathway.

Blogs on BAT2

There are no specific blogs for BAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BAT2 Antibody
35680002

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRC2A