BAIAP2L2 Antibody

Images

 
Immunohistochemistry-Paraffin: BAIAP2L2 Antibody [NBP1-83596] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAIAP2L2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAIAP2L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAIAP2L2 Protein (NBP1-83596PEP)
Publications
Read Publication using NBP1-83596.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAIAP2L2 Antibody

  • BAI1-associated protein 2-like 2
  • BAI1-associated protein 2-like protein 2
  • brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2
  • FLJ22582

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89537
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP1-85799
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BAIAP2L2 Antibody (NBP1-83596)(1)

Reviews for BAIAP2L2 Antibody (NBP1-83596) (0)

There are no reviews for BAIAP2L2 Antibody (NBP1-83596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BAIAP2L2 Antibody (NBP1-83596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAIAP2L2 Products

BAIAP2L2 NBP1-83596

Bioinformatics Tool for BAIAP2L2 Antibody (NBP1-83596)

Discover related pathways, diseases and genes to BAIAP2L2 Antibody (NBP1-83596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAIAP2L2 Antibody (NBP1-83596)

Discover more about diseases related to BAIAP2L2 Antibody (NBP1-83596).
 

Pathways for BAIAP2L2 Antibody (NBP1-83596)

View related products by pathway.

Blogs on BAIAP2L2

There are no specific blogs for BAIAP2L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAIAP2L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAIAP2L2