B4GALT3 Antibody

Images

 
Western Blot: B4GALT3 Antibody [NBP1-88653] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: B4GALT3 Antibody [NBP1-88653] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: B4GALT3 Antibody [NBP1-88653] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Western Blot: B4GALT3 Antibody [NBP1-88653] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: B4GALT3 Antibody [NBP1-88653] - Staining of human stomach shows strong granular cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B4GALT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
B4GALT3 Protein (NBP1-88653PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B4GALT3 Antibody

  • b4Gal-T3
  • beta-1,4-galactosyltransferase 3
  • Beta-1,4-GalTase 3
  • beta4Gal-T3
  • beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 3
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45912
Species: Hu
Applications: WB, IHC
NBP2-14342
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88653
Species: Hu, Mu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for B4GALT3 Antibody (NBP1-88653) (0)

There are no publications for B4GALT3 Antibody (NBP1-88653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT3 Antibody (NBP1-88653) (0)

There are no reviews for B4GALT3 Antibody (NBP1-88653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for B4GALT3 Antibody (NBP1-88653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B4GALT3 Products

Bioinformatics Tool for B4GALT3 Antibody (NBP1-88653)

Discover related pathways, diseases and genes to B4GALT3 Antibody (NBP1-88653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALT3 Antibody (NBP1-88653)

Discover more about diseases related to B4GALT3 Antibody (NBP1-88653).
 

Pathways for B4GALT3 Antibody (NBP1-88653)

View related products by pathway.

Research Areas for B4GALT3 Antibody (NBP1-88653)

Find related products by research area.

Blogs on B4GALT3

There are no specific blogs for B4GALT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B4GALT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT3