B4GALT3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS |
| Predicted Species |
Rat (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
B4GALT3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for B4GALT3 Antibody - BSA Free
Background
Several oligosaccharide structures and protein glycoconjugate types are found in nature. Homologous glycosyltransferase (GT) gene families catalyze the formation of glycosidic linkages. The beta-1,3 galactosyltransferase(beta3GalT) gene family encodes a set of type II transmembrane glycoproteins that are catalytically diverse and use different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine ) to catalyze the addition of an activated monosaccharide to a terminal lactose. The protein coding sequences for beta-1,3-Gal-T genes comprise a single exon and are distantly related to the Drosophila Brainiac gene. The beta-1,4-galactosyltransferase (beta4GalT) gene family encodes type II membrane-bound glycoproteins that show exclusive specificity for the donor substrate, UDP-galactose. beta-1,4Gal-T genes transfer galactose in a beta-1,4 linkage to similar acceptor sugars; each gene has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for B4GALT3 Antibody (NBP1-88653) (0)
There are no publications for B4GALT3 Antibody (NBP1-88653).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for B4GALT3 Antibody (NBP1-88653) (0)
There are no reviews for B4GALT3 Antibody (NBP1-88653).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for B4GALT3 Antibody (NBP1-88653) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional B4GALT3 Products
Research Areas for B4GALT3 Antibody (NBP1-88653)
Find related products by research area.
|
Blogs on B4GALT3