B4GALT3 Antibody - BSA Free

Western Blot: B4GALT3 Antibody [NBP1-88653] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunocytochemistry/Immunofluorescence: B4GALT3 Antibody [NBP1-88653] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: B4GALT3 Antibody [NBP1-88653] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Western Blot: B4GALT3 Antibody [NBP1-88653] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

B4GALT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit B4GALT3 Antibody - BSA Free (NBP1-88653) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B4GALT3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  B4GALT3 Protein (NBP1-88653PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B4GALT3 Antibody - BSA Free

• b4Gal-T3
• beta-1,4-galactosyltransferase 3
• Beta-1,4-GalTase 3
• beta4Gal-T3
• beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 3
• EC 2.4.1.-
• UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3
• UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3
• UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3

Background

Several oligosaccharide structures and protein glycoconjugate types are found in nature. Homologous glycosyltransferase (GT) gene families catalyze the formation of glycosidic linkages. The beta-1,3 galactosyltransferase(beta3GalT) gene family encodes a set of type II transmembrane glycoproteins that are catalytically diverse and use different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine ) to catalyze the addition of an activated monosaccharide to a terminal lactose. The protein coding sequences for beta-1,3-Gal-T genes comprise a single exon and are distantly related to the Drosophila Brainiac gene. The beta-1,4-galactosyltransferase (beta4GalT) gene family encodes type II membrane-bound glycoproteins that show exclusive specificity for the donor substrate, UDP-galactose. beta-1,4Gal-T genes transfer galactose in a beta-1,4 linkage to similar acceptor sugars; each gene has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: B4GALT3