beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody

Images

 
Western Blot: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP2-14342] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: ...read more
Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP2-14342] - Staining of human seminal vesicle shows high expression.
Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP2-14342] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP2-14342] - Staining in human seminal vesicle and pancreas tissues using anti-B4GALT2 antibody. ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
beta-1,4-Galactosyltransferase 2/B4GalT2 Protein (NBP2-14342PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody

  • B4GalT2
  • B4Gal-T2
  • B4Gal-T3
  • beta-1,4-Galactosyltransferase 2
  • Beta-1,4-GalTase 2
  • beta-4-GalT2
  • beta4Gal-T2
  • beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
  • UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2

Background

The B4GALT2 gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-boundglycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactosein a beta1,4 linkage to simi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88653
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88654
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP2-14342) (0)

There are no publications for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP2-14342).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP2-14342) (0)

There are no reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP2-14342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP2-14342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-1,4-Galactosyltransferase 2/B4GalT2 Products

Research Areas for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP2-14342)

Find related products by research area.

Blogs on beta-1,4-Galactosyltransferase 2/B4GalT2

There are no specific blogs for beta-1,4-Galactosyltransferase 2/B4GalT2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT2