B3GALT6 Antibody

Images

 
Western Blot: B3GALT6 Antibody [NBP1-69396] - This Anti-B3GALT6 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GALT6 Antibody Summary

Immunogen
Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected from the C terminal of B3GALT6. Peptide sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GALT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3GALT6 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GALT6 Antibody

  • beta-1,3-galactosyltransferase 6
  • Beta-1,3-GalTase 6
  • beta3GalT6
  • beta3Gal-T6
  • EC 2.4.1.134
  • Galactosyltransferase II
  • Galactosylxylosylprotein 3-beta-galactosyltransferase
  • UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6

Background

B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88652
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69327
Species: Hu
Applications: WB
AF1620
Species: Mu
Applications: WB, IHC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
46780002
Species: Hu
Applications: ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30879
Species: Hu
Applications: IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-35006
Species: Hu
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-69396
Species: Hu
Applications: WB

Publications for B3GALT6 Antibody (NBP1-69396) (0)

There are no publications for B3GALT6 Antibody (NBP1-69396).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALT6 Antibody (NBP1-69396) (0)

There are no reviews for B3GALT6 Antibody (NBP1-69396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALT6 Antibody (NBP1-69396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALT6 Products

Bioinformatics Tool for B3GALT6 Antibody (NBP1-69396)

Discover related pathways, diseases and genes to B3GALT6 Antibody (NBP1-69396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B3GALT6

There are no specific blogs for B3GALT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALT6
Uniprot