ASUN Antibody


Western Blot: ASUN Antibody [NBP1-70427] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ASUN Antibody Summary

Synthetic peptides corresponding to C12ORF11 The peptide sequence was selected from the middle region of C12orf11. Peptide sequence VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C12orf11 and was validated on Western blot.
Theoretical MW
80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASUN Antibody

  • ASUN
  • asunder, spermatogenesis regulator homolog (Drosphila)
  • cell cycle regulator Mat89Bb homolog
  • chromosome 12 open reading frame 11
  • FLJ10630
  • Mat89Bb
  • NET48
  • SPATA30


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB

Publications for ASUN Antibody (NBP1-70427) (0)

There are no publications for ASUN Antibody (NBP1-70427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASUN Antibody (NBP1-70427) (0)

There are no reviews for ASUN Antibody (NBP1-70427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASUN Antibody (NBP1-70427) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ASUN Products

ASUN NBP1-70427

Bioinformatics Tool for ASUN Antibody (NBP1-70427)

Discover related pathways, diseases and genes to ASUN Antibody (NBP1-70427). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASUN Antibody (NBP1-70427)

Discover more about diseases related to ASUN Antibody (NBP1-70427).

Pathways for ASUN Antibody (NBP1-70427)

View related products by pathway.

Blogs on ASUN

There are no specific blogs for ASUN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASUN Antibody and receive a gift card or discount.


Gene Symbol ASUN