ASK1 Recombinant Protein Antigen

Images

 
There are currently no images for ASK1 Recombinant Protein Antigen (NBP2-56971PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASK1.

Source: E. coli

Amino Acid Sequence: DEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP3K5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56971.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASK1 Recombinant Protein Antigen

  • Apoptosis signal-regulating kinase 1
  • ASK1
  • ASK-1
  • ASK1MEKK 5
  • EC 2.7.11
  • MAP/ERK kinase kinase 5
  • MAP3K5
  • MAPK/ERK kinase kinase 5
  • MAPKKK5EC 2.7.11.25
  • MEK kinase 5
  • MEKK5
  • MEKK5apoptosis signal regulating kinase 1
  • mitogen-activated protein kinase kinase kinase 5

Background

Apoptosis signal-regulating kinase-1 (ASK1, MEKK5, MAPKKK5) is a MAP3k type protein kinase belonging to mitogen-activated protein kinase kinase kinase (MAPKKK) family. As a regulator of JNK and p38 MAPK signaling pathways, ASK1/MEKK5 phosphorylates MMK4 to activate c-Jun N-terminal kinase (JNK) and phosphorylates MEK3 and MKK6 to activate p38. ASK1/MEKK5 is activated by oxidative stress, TNF via TRAF2, Fas via Daxx, calcium overload, and endoplasmic reticulum stress (1). ASK1/MEKK5 is inactivated by Trx, Grx, 14-3-3, and protein serine/threonine phosphatase 5 (2). While elevated level of ASK1/MEKK5 can induce apoptosis, a catalytically inactive ASK1/MEKK5 acts as an inhibitor in TNF-alpha induced apoptosis. Over-expression of ASK1/MEKK5 has also been implicated in cell differentiation, such as in keratinocyte differentiation through p38 pathway (3). ASK1/MEKK5 has been implicated as a therapeutic target for neurodegenerative disorder sand cardiac dysfunction (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-72710
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-52508
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC,  IHC-P, WB
NBP3-45606
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for ASK1 Recombinant Protein Antigen (NBP2-56971PEP) (0)

There are no publications for ASK1 Recombinant Protein Antigen (NBP2-56971PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASK1 Recombinant Protein Antigen (NBP2-56971PEP) (0)

There are no reviews for ASK1 Recombinant Protein Antigen (NBP2-56971PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASK1 Recombinant Protein Antigen (NBP2-56971PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASK1 Products

Research Areas for ASK1 Recombinant Protein Antigen (NBP2-56971PEP)

Find related products by research area.

Blogs on ASK1.

Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis
By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit...  Read full blog post.

IRE1 alpha dependent apoptotic-signaling pathway
Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K5