ASK1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ASK1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASK1.

  Source: E. coli

  Amino Acid Sequence: DEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MAP3K5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56971.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASK1 Recombinant Protein Antigen

• Apoptosis signal-regulating kinase 1
• ASK1
• ASK-1
• ASK1MEKK 5
• EC 2.7.11
• MAP/ERK kinase kinase 5
• MAP3K5
• MAPK/ERK kinase kinase 5
• MAPKKK5EC 2.7.11.25
• MEK kinase 5
• MEKK5
• MEKK5apoptosis signal regulating kinase 1
• mitogen-activated protein kinase kinase kinase 5

Background

Apoptosis signal-regulating kinase-1 (ASK1, MEKK5, MAPKKK5) is a MAP3k type protein kinase belonging to mitogen-activated protein kinase kinase kinase (MAPKKK) family. As a regulator of JNK and p38 MAPK signaling pathways, ASK1/MEKK5 phosphorylates MMK4 to activate c-Jun N-terminal kinase (JNK) and phosphorylates MEK3 and MKK6 to activate p38. ASK1/MEKK5 is activated by oxidative stress, TNF via TRAF2, Fas via Daxx, calcium overload, and endoplasmic reticulum stress (1). ASK1/MEKK5 is inactivated by Trx, Grx, 14-3-3, and protein serine/threonine phosphatase 5 (2). While elevated level of ASK1/MEKK5 can induce apoptosis, a catalytically inactive ASK1/MEKK5 acts as an inhibitor in TNF-alpha induced apoptosis. Over-expression of ASK1/MEKK5 has also been implicated in cell differentiation, such as in keratinocyte differentiation through p38 pathway (3). ASK1/MEKK5 has been implicated as a therapeutic target for neurodegenerative disorder sand cardiac dysfunction (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MAP3K5