ASK1 Antibody (2E6.)

Images

 
Western Blot: ASK1 Antibody (2E6) [H00004217-M04] - Analysis of MAP3K5 expression in A-431 (Cat # L015V1).
ELISA: ASK1 Antibody (2E6) [H00004217-M04] - Detection limit for recombinant GST tagged MAP3K5 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ASK1 Antibody (2E6.) Summary

Immunogen
MAP3K5 (AAH54503 1231 a.a. - 1374 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Specificity
MAP3K5 (2E6)
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASK1 Antibody (2E6.)

  • Apoptosis signal-regulating kinase 1
  • ASK1
  • ASK-1
  • ASK1MEKK 5
  • EC 2.7.11
  • MAP/ERK kinase kinase 5
  • MAP3K5
  • MAPK/ERK kinase kinase 5
  • MAPKKK5EC 2.7.11.25
  • MEK kinase 5
  • MEKK5
  • MEKK5apoptosis signal regulating kinase 1
  • mitogen-activated protein kinase kinase kinase 5

Background

Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protein kinase, MAPK kinase/MEK, which in turn activates MAPK. The kinases of these signaling cascades are highly conserved, and homologs exist in yeast, Drosophila, and mammalian cells. MAPKKK5 contains 1,374 amino acids with all 11 kinase subdomains. Northern blot analysis shows that MAPKKK5 transcript is abundantly expressed in human heart and pancreas. The MAPKKK5 protein phosphorylates and activates MKK4 (aliases SERK1, MAPKK4) in vitro, and activates c-Jun N-terminal kinase (JNK)/stress-activated protein kinase (SAPK) during transient expression in COS and 293 cells; MAPKKK5 does not activate MAPK/ERK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004217-M04
Species: Hu
Applications: WB, ELISA

Publications for ASK1 Antibody (H00004217-M04) (0)

There are no publications for ASK1 Antibody (H00004217-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASK1 Antibody (H00004217-M04) (0)

There are no reviews for ASK1 Antibody (H00004217-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASK1 Antibody (H00004217-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASK1 Products

Bioinformatics Tool for ASK1 Antibody (H00004217-M04)

Discover related pathways, diseases and genes to ASK1 Antibody (H00004217-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASK1 Antibody (H00004217-M04)

Discover more about diseases related to ASK1 Antibody (H00004217-M04).
 

Pathways for ASK1 Antibody (H00004217-M04)

View related products by pathway.

PTMs for ASK1 Antibody (H00004217-M04)

Learn more about PTMs related to ASK1 Antibody (H00004217-M04).
 

Research Areas for ASK1 Antibody (H00004217-M04)

Find related products by research area.

Blogs on ASK1.

IRE1 alpha dependent apoptotic-signaling pathway
Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASK1 Antibody (2E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K5
Entrez
OMIM
Uniprot