Recombinant Human ARMCX3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARMCX3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-379 of Human ARMCX3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE

Protein/Peptide Type
Recombinant Protein
Gene
ARMCX3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARMCX3 Protein

  • ALEX3arm protein lost in epithelial cancers, X chromosome, 3
  • ARM protein lost in epithelial cancers on chromosome X 3
  • armadillo repeat containing, X-linked 3
  • armadillo repeat-containing X-linked protein 3,1200004E24Rik
  • dJ545K15.2
  • DKFZp781N1954
  • KIAA0443
  • MGC12199
  • Protein ALEX3

Background

This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59021
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89144
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2864
Species: Hu
Applications: WB, ICC
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-129
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA

Publications for ARMCX3 Recombinant Protein (H00051566-P01) (0)

There are no publications for ARMCX3 Recombinant Protein (H00051566-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX3 Recombinant Protein (H00051566-P01) (0)

There are no reviews for ARMCX3 Recombinant Protein (H00051566-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMCX3 Recombinant Protein (H00051566-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARMCX3 Products

Bioinformatics Tool for ARMCX3 Recombinant Protein (H00051566-P01)

Discover related pathways, diseases and genes to ARMCX3 Recombinant Protein (H00051566-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMCX3 Recombinant Protein (H00051566-P01)

Discover more about diseases related to ARMCX3 Recombinant Protein (H00051566-P01).
 

Pathways for ARMCX3 Recombinant Protein (H00051566-P01)

View related products by pathway.

Blogs on ARMCX3

There are no specific blogs for ARMCX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARMCX3 Antibody
NBP1-89142
Rhot1 Antibody
NBP1-59021

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARMCX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMCX3