ARL8A Antibody


Immunohistochemistry: ARL8A Antibody [NBP2-14315] - Staining of human cerebral cortex shows moderate positivity in a subset of glial cells

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

ARL8A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK
Specificity of human ARL8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARL8A Protein (NBP2-14315PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARL8A Antibody

  • ADP-ribosylation factor-like 10B
  • ADP-ribosylation factor-like 8A
  • ADP-ribosylation factor-like protein 10B
  • ADP-ribosylation factor-like protein 8A
  • ARL10B
  • FLJ45195
  • GIE2
  • Novel small G protein indispensable for equal chromosome segregation 2
  • small G protein indispensable for equal chromosome segregation 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for ARL8A Antibody (NBP2-14315) (0)

There are no publications for ARL8A Antibody (NBP2-14315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL8A Antibody (NBP2-14315) (0)

There are no reviews for ARL8A Antibody (NBP2-14315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARL8A Antibody (NBP2-14315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARL8A Products

Bioinformatics Tool for ARL8A Antibody (NBP2-14315)

Discover related pathways, diseases and genes to ARL8A Antibody (NBP2-14315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ARL8A Antibody (NBP2-14315)

View related products by pathway.

PTMs for ARL8A Antibody (NBP2-14315)

Learn more about PTMs related to ARL8A Antibody (NBP2-14315).

Research Areas for ARL8A Antibody (NBP2-14315)

Find related products by research area.

Blogs on ARL8A

There are no specific blogs for ARL8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARL8A Antibody and receive a gift card or discount.


Gene Symbol ARL8A