ARL14 Antibody (2C8)

Images

 
Sandwich ELISA: ARL14 Antibody (2C8) [H00080117-M01] - Detection limit for recombinant GST tagged ARL14 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARL14 Antibody (2C8) Summary

Immunogen
ARF7 (AAH34354, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN
Specificity
ARL14 - ADP-ribosylation factor 7
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
ARL14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARL14 Antibody (2C8)

  • ADP-ribosylation factor 7FLJ22595
  • ADP-ribosylation factor-like 14
  • ADP-ribosylation factor-like protein 14
  • ARF7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00000381-M01
Species: Hu, Mu, Rt, Ba, Ca
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-16851
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87462
Species: Hu, Ca
Applications: WB, IHC, IHC-P
NBP2-48712
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NBP1-31004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26147
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
AF6144
Species: Hu
Applications: WB, Simple Western
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20261
Species: Hu
Applications: WB, ICC/IF
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARL14 Antibody (H00080117-M01) (0)

There are no publications for ARL14 Antibody (H00080117-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL14 Antibody (H00080117-M01) (0)

There are no reviews for ARL14 Antibody (H00080117-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARL14 Antibody (H00080117-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARL14 Products

Bioinformatics Tool for ARL14 Antibody (H00080117-M01)

Discover related pathways, diseases and genes to ARL14 Antibody (H00080117-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL14 Antibody (H00080117-M01)

Discover more about diseases related to ARL14 Antibody (H00080117-M01).
 

Pathways for ARL14 Antibody (H00080117-M01)

View related products by pathway.

Research Areas for ARL14 Antibody (H00080117-M01)

Find related products by research area.

Blogs on ARL14

There are no specific blogs for ARL14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL14 Antibody (2C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL14
Entrez
Uniprot