ARL13B Antibody


Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining in human testis and skeletal muscle tissues using anti-ARL13B antibody. Corresponding ARL13B RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

ARL13B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNY YAESYGVIFVVDSSDEERMEETKEAMSEMLR
Specificity of human ARL13B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARL13B Protein (NBP2-14312PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARL13B Antibody

  • ADP-ribosylation factor-like 13B
  • ADP-ribosylation factor-like 2-like 1
  • ADP-ribosylation factor-like protein 13B
  • ADP-ribosylation factor-like protein 2-like 1
  • ARL2L1MGC120611
  • ARL2-like protein 1
  • DKFZp686E2075
  • DKFZp686L2472
  • DKFZp761H079
  • JBTS8DKFZp686M2074
  • MGC120612


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for ARL13B Antibody (NBP2-14312) (0)

There are no publications for ARL13B Antibody (NBP2-14312).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL13B Antibody (NBP2-14312) (0)

There are no reviews for ARL13B Antibody (NBP2-14312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARL13B Antibody (NBP2-14312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARL13B Products

Bioinformatics Tool for ARL13B Antibody (NBP2-14312)

Discover related pathways, diseases and genes to ARL13B Antibody (NBP2-14312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL13B Antibody (NBP2-14312)

Discover more about diseases related to ARL13B Antibody (NBP2-14312).

Pathways for ARL13B Antibody (NBP2-14312)

View related products by pathway.

PTMs for ARL13B Antibody (NBP2-14312)

Learn more about PTMs related to ARL13B Antibody (NBP2-14312).

Blogs on ARL13B

There are no specific blogs for ARL13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARL13B Antibody and receive a gift card or discount.


Gene Symbol ARL13B