AP4E1 Recombinant Protein Antigen

Images

 
There are currently no images for AP4E1 Protein (NBP1-89056PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AP4E1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP4E1.

Source: E.coli

Amino Acid Sequence: AELNHNVTYAILFECVHTVYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALTYVIQQDPTLALQHQMTIIECLDHPDPIIKRETLELLYRITNAQNITV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AP4E1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89056.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for AP4E1 Recombinant Protein Antigen

  • Adapter-related protein complex 4 subunit epsilon-1
  • adaptor-related protein complex 4, epsilon 1 subunit
  • adaptor-related protein complex AP-4 epsilon
  • AP-4 adapter complex subunit epsilon
  • AP-4 complex subunit epsilon-1
  • AP-4-EPSILON
  • DKFZp686L12167
  • Epsilon subunit of AP-4
  • epsilon-adaptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89060
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00010717-Q01
Species: Hu
NBP2-55178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89059
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56456
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92058
Species: Hu, Mu
Applications: WB
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP2-49265
Species: Hu
Applications: IHC, IHC-P
NB100-1063
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001175-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22544
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89058
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AP4E1 Protein (NBP1-89056PEP) (0)

There are no publications for AP4E1 Protein (NBP1-89056PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP4E1 Protein (NBP1-89056PEP) (0)

There are no reviews for AP4E1 Protein (NBP1-89056PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AP4E1 Protein (NBP1-89056PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional AP4E1 Products

Array NBP1-89056PEP

Bioinformatics Tool for AP4E1 Protein (NBP1-89056PEP)

Discover related pathways, diseases and genes to AP4E1 Protein (NBP1-89056PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP4E1 Protein (NBP1-89056PEP)

Discover more about diseases related to AP4E1 Protein (NBP1-89056PEP).
 

Pathways for AP4E1 Protein (NBP1-89056PEP)

View related products by pathway.

Blogs on AP4E1

There are no specific blogs for AP4E1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AP4E1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AP4E1